Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Photoreceptor disk component PRCD (PRCD)

This Recombinant Human Photoreceptor disk component PRCD (PRCD) spans the amino acid sequence from region 1-54. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Photoreceptor disk component PRCD; Progressive rod-cone degeneration protein; PRCD

UniProt

Q00LT1

Expression Region

1-54

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LASS4 Antibody Blocking Peptide
orb1515968 500 µg

LASS4 Antibody Blocking Peptide

Sign In for Pricing
View Details
OR4X1 HDR Plasmid (h)
sc-415864-HDR 20 µg

OR4X1 HDR Plasmid (h)

Sign In for Pricing
View Details
RANBP9 Mouse mAb
E2618309 100 µL

RANBP9 Mouse mAb

Sign In for Pricing
View Details
ZNF263 Antibody
orb2679229-01 50 µL

ZNF263 Antibody

Sign In for Pricing
View Details
ZNF263 Antibody
orb2679229-02 100 µL

ZNF263 Antibody

Sign In for Pricing
View Details
ZNF263 Antibody
orb2679229-03 200 µL

ZNF263 Antibody

Sign In for Pricing
View Details