Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-9 receptor (IL9R), partial

This Recombinant Human Interleukin-9 receptor (IL9R), partial spans the amino acid sequence from region 41-270. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-9 receptor; IL-9 receptor; IL-9R; CD antigen CD129; IL9R

UniProt

Q01113

Expression Region

41-270

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary
CB500532 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Purified Anti-Human CD44 Antibody
RD22260F-01 25 µg

Purified Anti-Human CD44 Antibody

Sign In for Pricing
View Details
Purified Anti-Human CD44 Antibody
RD22260F-02 100 µg

Purified Anti-Human CD44 Antibody

Sign In for Pricing
View Details
LIAS (NM_006859) Human Recombinant Protein
TP762621 50 µg

LIAS (NM_006859) Human Recombinant Protein

Sign In for Pricing
View Details
PE Anti-Mouse CD8b.2 Antibody[53-5.8]
AN00564D-01 50 Tests

PE Anti-Mouse CD8b.2 Antibody[53-5.8]

Sign In for Pricing
View Details
PE Anti-Mouse CD8b.2 Antibody[53-5.8]
AN00564D-02 100 Tests

PE Anti-Mouse CD8b.2 Antibody[53-5.8]

Sign In for Pricing
View Details