Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial

This Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial spans the amino acid sequence from region 260-338. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel protein type 7 subunit alpha; Atypical sodium channel Nav2.1; Nax channel; Sodium channel protein type VII subunit alpha; SCN7A SCN6A

UniProt

Q01118

Expression Region

260-338

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERTAD1 Protein Vector (Rat) (pPM-C-HA)
PV304384 500 ng

SERTAD1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
WNK1, CT (Serine/Threonine-protein Kinase WNK1, Protein Kinase With No Lysine 1, hWNK1, PRKWNK1, Protein Kinase, Lysine Deficient 1, Kinase Deficient Protein, Erythrocyte 65kD Protein, p65, KDP, KIAA0344) (APC) discontinued
W2996-01B-APC 200 µL

WNK1, CT (Serine/Threonine-protein Kinase WNK1, Protein Kinase With No Lysine 1, hWNK1, PRKWNK1, Protein Kinase, Lysine Deficient 1, Kinase Deficient Protein, Erythrocyte 65kD Protein, p65, KDP, KIAA0344) (APC) discontinued

Sign In for Pricing
View Details
Lentiviral human DLX6 sgRNA gene knockout kit - Lentiviral human DLX6 sgRNA gene knockout kit (plasmid)
GTR15397973 1 Vial

Lentiviral human DLX6 sgRNA gene knockout kit - Lentiviral human DLX6 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
PRAME like-3 Lentiviral Activation Particles (m2)
sc-429926-LAC-2 200 µL

PRAME like-3 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
TTRAP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2553605 3x 1.0 µg

TTRAP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Monkey Annexin A2 ELISA Kit
MBS742773-01 48 Well

Monkey Annexin A2 ELISA Kit

Sign In for Pricing
View Details