Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (FCERB), partial
This Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (FCERB), partial spans the amino acid sequence from region 151-180. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
High affinity immunoglobulin epsilon receptor subunit beta; FcERI; Fc epsilon receptor I beta-chain; IgE Fc receptor subunit beta; Membrane-spanning 4-domains subfamily A member 2; MS4A2 APY FCER1B IGER
UniProt
Q01362
Expression Region
151-180
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
NLKKSLAYIHIHSCQKFFETKCFMASFSTE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog