Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OTU domain-containing protein 4 (OTUD4), partial

This Recombinant Human OTU domain-containing protein 4 (OTUD4), partial spans the amino acid sequence from region 34-155. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OTU domain-containing protein 4; EC 3.4.19.12; HIV-1-induced protein HIN-1; OTUD4 HIN-1 KIAA1046

UniProt

Q01804

Expression Region

34-155

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGNHYDIVYPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dithieno[3,2-b:2',3'-d]thiophene-2-boronic Acid
TRC-D493923-1G 1 g

Dithieno[3,2-b:2',3'-d]thiophene-2-boronic Acid

Sign In for Pricing
View Details
FAM48A sgRNA CRISPR Lentivector (Human) (Target 2)
K0723903 1.0 µg DNA

FAM48A sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
MYCT1, CT (MYCT1, MTLC, MTMC1, Myc target protein 1, Myc target in myeloid cells protein 1) (Biotin) discontinued
038724-Biotin 200 µL

MYCT1, CT (MYCT1, MTLC, MTMC1, Myc target protein 1, Myc target in myeloid cells protein 1) (Biotin) discontinued

Sign In for Pricing
View Details
PSMA1 antibody
70R-4758 50 ug

PSMA1 antibody

Sign In for Pricing
View Details
VP3 (NC_015150) Virus Tagged ORF Clone
VC102091 10 µg

VP3 (NC_015150) Virus Tagged ORF Clone

Sign In for Pricing
View Details
Canine Centromere protein U (MLF1IP) ELISA kit
GTR10377753 96 Well

Canine Centromere protein U (MLF1IP) ELISA kit

Sign In for Pricing
View Details