Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 (PLCB3), partial

This Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 (PLCB3), partial spans the amino acid sequence from region 318-468. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3; EC 3.1.4.11; Phosphoinositide phospholipase C-beta-3; Phospholipase C-beta-3; PLC-beta-3; PLCB3

UniProt

Q01970

Expression Region

318-468

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRCVELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAKQQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RP34 3'UTR Luciferase Stable Cell Line
TU020384 1.0 mL

RP34 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CYTH4 Antibody - middle region
ARP77293_P050-25UL 25 µL

CYTH4 Antibody - middle region

Sign In for Pricing
View Details
Recombinant Treponema Pallidum atpE Protein (aa 1-232) (strain Nichols)
VAng-Cr1120-500gEcoli 500 µg (E. coli)

Recombinant Treponema Pallidum atpE Protein (aa 1-232) (strain Nichols)

Sign In for Pricing
View Details
Human Slit3 (Slit Homolog 3) ELISA Kit
MBS8804545-01 48 Well

Human Slit3 (Slit Homolog 3) ELISA Kit

Sign In for Pricing
View Details
Human Slit3 (Slit Homolog 3) ELISA Kit
MBS8804545-02 96 Well

Human Slit3 (Slit Homolog 3) ELISA Kit

Sign In for Pricing
View Details
Human Slit3 (Slit Homolog 3) ELISA Kit
MBS8804545-03 5x 96 Well

Human Slit3 (Slit Homolog 3) ELISA Kit

Sign In for Pricing
View Details