Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial

This Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial spans the amino acid sequence from region 50-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 6A2, mitochondrial; Cytochrome c oxidase polypeptide VIa-heart; COXVIAH; Cytochrome c oxidase subunit VIA-muscle; COX VIa-M; COX6A2 COX6A COX6AH

UniProt

Q02221

Expression Region

50-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA/Hemagglutinin, H1N1 (sf9, His)
HY-P72800-01 10 µg

HA/Hemagglutinin, H1N1 (sf9, His)

Sign In for Pricing
View Details
HA/Hemagglutinin, H1N1 (sf9, His)
HY-P72800-02 50 µg

HA/Hemagglutinin, H1N1 (sf9, His)

Sign In for Pricing
View Details
HA/Hemagglutinin, H1N1 (sf9, His)
HY-P72800-03 100 µg

HA/Hemagglutinin, H1N1 (sf9, His)

Sign In for Pricing
View Details
Parainfluenza Virus Type 1 (APC)
P3107-10C-APC 100 µL

Parainfluenza Virus Type 1 (APC)

Sign In for Pricing
View Details
Horse Lysophosphatidic Acid Receptor 1 ELISA Kit
MBS091352-01 48 Well

Horse Lysophosphatidic Acid Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Horse Lysophosphatidic Acid Receptor 1 ELISA Kit
MBS091352-02 96 Well

Horse Lysophosphatidic Acid Receptor 1 ELISA Kit

Sign In for Pricing
View Details