Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Contactin-2 (CNTN2), partial

This Recombinant Human Contactin-2 (CNTN2), partial spans the amino acid sequence from region 610-708. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Contactin-2; Axonal glycoprotein TAG-1; Axonin-1; Transient axonal glycoprotein 1; TAX-1; CNTN2 AXT TAG1 TAX1

UniProt

Q02246

Expression Region

610-708

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE6 beta (PDE6B) (NM_000283) Human Over-expression Lysate
LC400109 20 µg

PDE6 beta (PDE6B) (NM_000283) Human Over-expression Lysate

Sign In for Pricing
View Details
SPHK2 (C-term) Rabbit Polyclonal Antibody
AP13925PU-N 200 µL

SPHK2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AKR1C1 Mouse Monoclonal Antibody [5-F10]
EM1701-21 100 µL

AKR1C1 Mouse Monoclonal Antibody [5-F10]

Sign In for Pricing
View Details
1,2,3,4,5,6,7-Heptachloronaphthalene (>90%)
TRC-H265210-1MG 1 mg

1,2,3,4,5,6,7-Heptachloronaphthalene (>90%)

Sign In for Pricing
View Details
PhosphoWorks™ Luminometric ATP Assay Kit *DTT-Free*
21613-AAT 10 Plates

PhosphoWorks™ Luminometric ATP Assay Kit *DTT-Free*

Sign In for Pricing
View Details
Colloidal Gold Conjugated Ricinus communis Lectin (Castor Bean) -RCA-I-,  30nm
GP-2001-30 1 mL

Colloidal Gold Conjugated Ricinus communis Lectin (Castor Bean) -RCA-I-, 30nm

Sign In for Pricing
View Details