Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Contactin-2 (CNTN2), partial

This Recombinant Human Contactin-2 (CNTN2), partial spans the amino acid sequence from region 610-708. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Contactin-2; Axonal glycoprotein TAG-1; Axonin-1; Transient axonal glycoprotein 1; TAX-1; CNTN2 AXT TAG1 TAX1

UniProt

Q02246

Expression Region

610-708

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPV-16 (Human Papilloma Virus 16) (HPV16/2058R), CF594 conjugate, 0.1mg/mL
BNC942058-500 1x 500 µL

HPV-16 (Human Papilloma Virus 16) (HPV16/2058R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CGREF1 (NM_006569) Human Recombinant Protein
TP306520M 100 µg

CGREF1 (NM_006569) Human Recombinant Protein

Sign In for Pricing
View Details
2-Naphthylamine Hydrochloride
TRC-N378020-10MG 10 mg

2-Naphthylamine Hydrochloride

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (3E6), CF488A conjugate, 0.1mg/mL
BNC881777-500 1x 500 µL

Prostate Specific Antigen (PSA) (3E6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD168 (HMMR) (C-term) Rabbit Polyclonal Antibody
AP52063PU-N 400 µL

CD168 (HMMR) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF568 conjugate, 0.1mg/mL
BNC681175-100 1x 100 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details