Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H1.1 (H11)

This Recombinant Human Histone H1.1 (H11) spans the amino acid sequence from region 2-215. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H1.1; Histone H1a; H1-1 H1F1 HIST1H1A

UniProt

Q02539

Expression Region

2-215

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdcd11 ORF Vector (Rat) (pORF)
36259016 1.0 µg DNA

Pdcd11 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CD83, Cynomolgus (HEK293, Fc)
HY-P76245 1 Each

CD83, Cynomolgus (HEK293, Fc)

Sign In for Pricing
View Details
IAH1 Over-expression Lysate Product
GWB-E4ABD4 0.1 mg

IAH1 Over-expression Lysate Product

Sign In for Pricing
View Details
p38 MAP Kinase Blocking Peptide
33R-10448 50 ug

p38 MAP Kinase Blocking Peptide

Sign In for Pricing
View Details
INTS4L1 Recombinant Protein (Human)
RP065793 100 µg

INTS4L1 Recombinant Protein (Human)

Sign In for Pricing
View Details
CBX3 Monoclonal Antibody
MBS7135490-01 0.05 mg

CBX3 Monoclonal Antibody

Sign In for Pricing
View Details