Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Helix-loop-helix protein 2 (HEN2)

This Recombinant Human Helix-loop-helix protein 2 (HEN2) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Helix-loop-helix protein 2; HEN-2; Class A basic helix-loop-helix protein 34; bHLHa34; Nescient helix loop helix 2; NSCL-2; NHLH2 BHLHA34 HEN2 KIAA0490

UniProt

Q02577

Expression Region

1-135

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bungarus candidus Phospholipase A2, beta bungarotoxin A2 chain
MBS1334860-01 0.02 mg (E-Coli)

Recombinant Bungarus candidus Phospholipase A2, beta bungarotoxin A2 chain

Sign In for Pricing
View Details
Recombinant Bungarus candidus Phospholipase A2, beta bungarotoxin A2 chain
MBS1334860-02 0.1 mg (E-Coli)

Recombinant Bungarus candidus Phospholipase A2, beta bungarotoxin A2 chain

Sign In for Pricing
View Details
Recombinant Bungarus candidus Phospholipase A2, beta bungarotoxin A2 chain
MBS1334860-03 0.02 mg (Yeast)

Recombinant Bungarus candidus Phospholipase A2, beta bungarotoxin A2 chain

Sign In for Pricing
View Details
Recombinant Bungarus candidus Phospholipase A2, beta bungarotoxin A2 chain
MBS1334860-04 0.1 mg (Yeast)

Recombinant Bungarus candidus Phospholipase A2, beta bungarotoxin A2 chain

Sign In for Pricing
View Details
Recombinant Bungarus candidus Phospholipase A2, beta bungarotoxin A2 chain
MBS1334860-05 0.02 mg (Baculovirus)

Recombinant Bungarus candidus Phospholipase A2, beta bungarotoxin A2 chain

Sign In for Pricing
View Details
Recombinant Bungarus candidus Phospholipase A2, beta bungarotoxin A2 chain
MBS1334860-06 0.02 mg (Mammalian-Cell)

Recombinant Bungarus candidus Phospholipase A2, beta bungarotoxin A2 chain

Sign In for Pricing
View Details