Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth hormone-releasing hormone receptor (GHRHR), partial

This Recombinant Human Growth hormone-releasing hormone receptor (GHRHR), partial spans the amino acid sequence from region 23-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Growth hormone-releasing hormone receptor; GHRH receptor; Growth hormone-releasing factor receptor; GRF receptor; GRFR; GHRHR

UniProt

Q02643

Expression Region

23-130

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Legumain (LGMN) ELISA Kit
NSL1295Bo 96 Tests

Bovine Legumain (LGMN) ELISA Kit

Sign In for Pricing
View Details
Random Primer 9
S1254S 1 A260 Units

Random Primer 9

Sign In for Pricing
View Details
Zbtb7b 3'UTR GFP Stable Cell Line
TU273573 1.0 mL

Zbtb7b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Anti Human RHO Monoclonal Clone AADI-18 100UL
IRBAHURHOAADI18C100UL 100 µL

Rabbit Anti Human RHO Monoclonal Clone AADI-18 100UL

Sign In for Pricing
View Details
ST3GAL3 (NM_174970) Human Untagged Clone
SC309563 10 µg

ST3GAL3 (NM_174970) Human Untagged Clone

Sign In for Pricing
View Details
LILRB5 CRISPR All-in-one AAV vector set (with saCas9)(Human)
26531151 3x 1.0 µg DNA

LILRB5 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details