Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 6-pyruvoyl tetrahydrobiopterin synthase (PTPS)

This Recombinant Human 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) spans the amino acid sequence from region 1-145. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

6-pyruvoyl tetrahydrobiopterin synthase; PTP synthase; PTPS; EC 4.2.3.12; PTS

UniProt

Q03393

Expression Region

1-145

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LKB1 (E-9) : m-IgG1 BP-HRP Bundle
sc-543652 1 Kit

LKB1 (E-9) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
SUMO1 Rabbit Monoclonal Antibody
E10G22057 100 µL

SUMO1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Magnesium Sulfate
TRC-M198130-10G 10 g

Magnesium Sulfate

Sign In for Pricing
View Details
Vom1r75 Rat siRNA Oligo Duplex (Locus ID 494314)
SR508481 1 Kit

Vom1r75 Rat siRNA Oligo Duplex (Locus ID 494314)

Sign In for Pricing
View Details
HCV Nonstructural Protein 4A, B [Biotin]
DAG1424 100 µg

HCV Nonstructural Protein 4A, B [Biotin]

Sign In for Pricing
View Details
VPS26 Antibody BIOTIN-Conjugated
MBS5400228-01 0.1 mg

VPS26 Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details