Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (X) chain (COAA1)

This Recombinant Human Collagen alpha-1 (X) chain (COAA1) spans the amino acid sequence from region 19-680. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagen alpha-1 (X; chain COL10A1

UniProt

Q03692

Expression Region

19-680

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQGTPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGEPGLPGPPGPSAVGKPGVPGLPGKPGERGPYGPKGDVGPAGLPGPRGPPGPPGIPGPAGISVPGKPGQQGPTGAPGPRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDPGVGGPPGLPGPVGPAGAKGMPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGDPGSPGPPGPAGIATKGLNGPTGPPGPPGPRGHSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD72 Antibody (045) [Alexa Fluor 405]
NBP3-06095AF405 0.1 mL

Rabbit Monoclonal CD72 Antibody (045) [Alexa Fluor 405]

Sign In for Pricing
View Details
LPHN1 Polyclonal Antibody
MBS9236624-01 0.1 mL

LPHN1 Polyclonal Antibody

Sign In for Pricing
View Details
LPHN1 Polyclonal Antibody
MBS9236624-02 5x 0.1 mL

LPHN1 Polyclonal Antibody

Sign In for Pricing
View Details
Donkey E3 Ubiquitin-Protein Ligase Praja-2 (PJA2) ELISA Kit
MBS9946184 Inquire

Donkey E3 Ubiquitin-Protein Ligase Praja-2 (PJA2) ELISA Kit

Sign In for Pricing
View Details
(E) -8-Dodecenyl acetate
orb2300251-01 1 mg

(E) -8-Dodecenyl acetate

Sign In for Pricing
View Details
(E) -8-Dodecenyl acetate
orb2300251-02 5 mg

(E) -8-Dodecenyl acetate

Sign In for Pricing
View Details