Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 1,4-alpha-glucan-branching enzyme (GLGB)

This Recombinant Human 1,4-alpha-glucan-branching enzyme (GLGB) spans the amino acid sequence from region 2-702. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1,4-alpha-glucan-branching enzyme; EC 2.4.1.18; Brancher enzyme; Glycogen-branching enzyme; GBE1

UniProt

Q04446

Expression Region

2-702

Origin

Homo sapiens (Human)

Field of Research

Protein Biochemistry

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGTPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEILRFLLSNIRWWLEEYRFDGFRFDGVTSMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS4Y1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV782370 1.0 µg DNA

RPS4Y1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Anti-Rat CD4 (OX-38) In Vivo Antibody - Low Endotoxin
ICH1255-5mg 5 mg

Anti-Rat CD4 (OX-38) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
ZNFX1 Recombinant Rabbit mAb
BS48268-01 50 µL

ZNFX1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
ZNFX1 Recombinant Rabbit mAb
BS48268-02 100 µL

ZNFX1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rabbit NUP35 (Nucleoporin 35kDa) ELISA Kit
MBS2508216-01 24 Tests

Rabbit NUP35 (Nucleoporin 35kDa) ELISA Kit

Sign In for Pricing
View Details
Rabbit NUP35 (Nucleoporin 35kDa) ELISA Kit
MBS2508216-02 48 Tests

Rabbit NUP35 (Nucleoporin 35kDa) ELISA Kit

Sign In for Pricing
View Details