Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial

This Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial spans the amino acid sequence from region 676-714. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Copper-transporting ATPase 1; EC 7.2.2.8; Copper pump 1; Menkes disease-associated protein; ATP7A MC1 MNK

UniProt

Q04656

Expression Region

676-714

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Hydroxy-1-phenylpentane
TRC-H950895-500MG 500 mg

2-Hydroxy-1-phenylpentane

Sign In for Pricing
View Details
2 Hydroxy phytanoyl CoA lyase (HACL1) Rabbit Polyclonal Antibody
TA364835 100 µL

2 Hydroxy phytanoyl CoA lyase (HACL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ABCD1 Human Knockdown Lysate
LY300014 100 µg

ABCD1 Human Knockdown Lysate

Sign In for Pricing
View Details
Resorcinol Sulfide (>80%)
TRC-R225345-250MG 250 mg

Resorcinol Sulfide (>80%)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS518160 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Mouse Arx activation kit by CRISPRa
GA200292 1 Kit

Mouse Arx activation kit by CRISPRa

Sign In for Pricing
View Details