Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial

This Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial spans the amino acid sequence from region 676-714. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Copper-transporting ATPase 1; EC 7.2.2.8; Copper pump 1; Menkes disease-associated protein; ATP7A MC1 MNK

UniProt

Q04656

Expression Region

676-714

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p-Anisaldehyde Propylene Glycol Acetal-d3
TRC-A673212-2.5MG 2.5 mg

p-Anisaldehyde Propylene Glycol Acetal-d3

Sign In for Pricing
View Details
APC Anti-Human CD80 Antibody[2F4]
E-AB-F1365E-01 20 Tests

APC Anti-Human CD80 Antibody[2F4]

Sign In for Pricing
View Details
APC Anti-Human CD80 Antibody[2F4]
E-AB-F1365E-02 100 Tests

APC Anti-Human CD80 Antibody[2F4]

Sign In for Pricing
View Details
APC Anti-Human CD80 Antibody[2F4]
E-AB-F1365E-03 2x 100 Tests

APC Anti-Human CD80 Antibody[2F4]

Sign In for Pricing
View Details
SLC22A4 Human Gene Knockout Kit (CRISPR)
KN206575 1 Kit

SLC22A4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Tmprss6 activation kit by CRISPRa
GA208926 1 Kit

Mouse Tmprss6 activation kit by CRISPRa

Sign In for Pricing
View Details