Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A8, Human (N-His)

S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8 Protein, Human (N-His) is the recombinant human-derived S100A8 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A8 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a8-protein-human-n-his.html

Purity

98.0

Smiles

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Molecular Formula

6279 (Gene_ID) P05109 (M1-E93) (Accession)

Molecular Weight

Approximately 12-13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti SUMO1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) 120ul
IRBAMLSUMO1AP998120UL 120 µL

Rabbit Anti SUMO1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,IHC-p,Immunofluorescence,ELISA) 120ul

Sign In for Pricing
View Details
Autophagy Related Protein 7 (ATG7) Antibody (APC)
abx446876 100 µg

Autophagy Related Protein 7 (ATG7) Antibody (APC)

Sign In for Pricing
View Details
Enpep Rat Monoclonal Antibody [Clone ID: FG35.4]
AM08057RP-S 100 µg

Enpep Rat Monoclonal Antibody [Clone ID: FG35.4]

Sign In for Pricing
View Details
KMT5C Antibody (Biotin)
orb752603-01 50 μL

KMT5C Antibody (Biotin)

Sign In for Pricing
View Details
KMT5C Antibody (Biotin)
orb752603-02 100 µL

KMT5C Antibody (Biotin)

Sign In for Pricing
View Details
TNIP2 Antibody
OACD07909-100UL 100 µL

TNIP2 Antibody

Sign In for Pricing
View Details