Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin receptor type-1 (ACVR1), partial

This Recombinant Human Activin receptor type-1 (ACVR1), partial spans the amino acid sequence from region 21-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type-1; EC 2.7.11.30; Activin receptor type I; ACTR-I; Activin receptor-like kinase 2; ALK-2; Serine/threonine-protein kinase receptor R1; SKR1; TGF-B superfamily receptor type I; TSR-I; ACVR1 ACVRLK2

UniProt

Q04771

Expression Region

21-123

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC498339 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6004603 1.0 µg DNA

LOC498339 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Cttnbp2 (NM_001114401) Rat Tagged ORF Clone
RR213908 10 µg

Cttnbp2 (NM_001114401) Rat Tagged ORF Clone

Sign In for Pricing
View Details
C3orf43 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0231207 1.0 µg DNA

C3orf43 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
HPGDS inhibitor 3
T61250-01 25 mg

HPGDS inhibitor 3

Sign In for Pricing
View Details
HPGDS inhibitor 3
T61250-02 50 mg

HPGDS inhibitor 3

Sign In for Pricing
View Details
HPGDS inhibitor 3
T61250-03 100 mg

HPGDS inhibitor 3

Sign In for Pricing
View Details