Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin receptor type-1 (ACVR1), partial

This Recombinant Human Activin receptor type-1 (ACVR1), partial spans the amino acid sequence from region 21-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type-1; EC 2.7.11.30; Activin receptor type I; ACTR-I; Activin receptor-like kinase 2; ALK-2; Serine/threonine-protein kinase receptor R1; SKR1; TGF-B superfamily receptor type I; TSR-I; ACVR1 ACVRLK2

UniProt

Q04771

Expression Region

21-123

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1H-Indol-3-ylmethyl) - (tetrahydro-furan-2-ylmethyl) -amine
sc-304194 500 mg

(1H-Indol-3-ylmethyl) - (tetrahydro-furan-2-ylmethyl) -amine

Sign In for Pricing
View Details
Salmonella enteritidis (PE)
S0060-40B-PE 100 µL

Salmonella enteritidis (PE)

Sign In for Pricing
View Details
Rabbit Polyclonal GPRASP1 Antibody [Alexa Fluor 405]
NBP2-81951AF405 0.1 mL

Rabbit Polyclonal GPRASP1 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Rabbit anti-ABCC13 Antibody
YLD0059-01 50 µL

Rabbit anti-ABCC13 Antibody

Sign In for Pricing
View Details
Rabbit anti-ABCC13 Antibody
YLD0059-02 100 µL

Rabbit anti-ABCC13 Antibody

Sign In for Pricing
View Details
MED8 Antibody - middle region (ARP81954_P050)
ARP81954_P050 100 µL

MED8 Antibody - middle region (ARP81954_P050)

Sign In for Pricing
View Details