Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Focal adhesion kinase 1 (FAK1), partial

This Recombinant Human Focal adhesion kinase 1 (FAK1), partial spans the amino acid sequence from region 35-355. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Focal adhesion kinase 1; FADK 1; EC 2.7.10.2; Focal adhesion kinase-related nonkinase; FRNK; Protein phosphatase 1 regulatory subunit 71; PPP1R71; Protein-tyrosine kinase 2; p125FAK; pp125FAK; PTK2 FAK FAK1

UniProt

Q05397

Expression Region

35-355

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human RNF122 (Ring finger protein 122) for Antibody Discovery
MP1049J Each

Magic™ Membrane Protein Human RNF122 (Ring finger protein 122) for Antibody Discovery

Sign In for Pricing
View Details
Recombinant Human IDH1 Protein, N-His
orb2969814-01 50 µg

Recombinant Human IDH1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IDH1 Protein, N-His
orb2969814-02 100 µg

Recombinant Human IDH1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IDH1 Protein, N-His
orb2969814-03 1 mg

Recombinant Human IDH1 Protein, N-His

Sign In for Pricing
View Details
RNU7-25P 3'UTR GFP Stable Cell Line
TU070248 1.0 mL

RNU7-25P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ferroportin (FPN) BioAssayTM ELISA Kit (Human)
517197 96 Tests

Ferroportin (FPN) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details