Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (XIV) chain (COEA1), partial

This Recombinant Human Collagen alpha-1 (XIV) chain (COEA1), partial spans the amino acid sequence from region 1229-1424. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagen alpha-1 (XIV; chain; Undulin; COL14A1 UND

UniProt

Q05707

Expression Region

1229-1424

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GFKMMEMFGLVEKDFSSVEGVSMEPGTFNVFPCYQLHKDALVSQPTRYLHPEGLPSDYTISFLFRILPDTPQEPFALWEILNKNSDPLVGVILDNGGKTLTYFNYDQSGDFQTVTFEGPEIRKIFYGSFHKLHIVVSETLVKVVIDCKQVGEKAMNASANITSDGVEVLGKMVRSRGPGGNSAPFQLQMFDIVCST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC6 Antibody
KC-3802-01 50 μL

APC6 Antibody

Sign In for Pricing
View Details
APC6 Antibody
KC-3802-02 100 µL

APC6 Antibody

Sign In for Pricing
View Details
APC6 Antibody
KC-3802-03 1 mL

APC6 Antibody

Sign In for Pricing
View Details
ARL2 (NM_001667) Human Over-expression Lysate
LC419817 20 µg

ARL2 (NM_001667) Human Over-expression Lysate

Sign In for Pricing
View Details
LOC100287534 Human Gene Knockout Kit (CRISPR)
KN434031 1 Kit

LOC100287534 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDE4C (NM_001098819) Human Over-expression Lysate
LC420351 20 µg

PDE4C (NM_001098819) Human Over-expression Lysate

Sign In for Pricing
View Details