Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha (P2R3A), partial

This Recombinant Human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha (P2R3A), partial spans the amino acid sequence from region 758-793. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha; PP2A subunit B isoform PR72/PR130; PP2A subunit B isoform R3 isoform; PP2A subunit B isoforms B''-PR72/PR130; PP2A subunit B isoforms B72/B130; Serine/threonine-protein phosphatase 2A 72/130 kDa regulatory subunit B; PPP2R3A PPP2R3

UniProt

Q06190

Expression Region

758-793

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CPLYWKAPMFRAAGGEKTGFVTAQSFIAMWRKLLNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zonula occludens protein 3/TJP3 Antibody Picoband®, Carrier-free
PA1973-carrier-free 100 µg/Vial

Anti-Zonula occludens protein 3/TJP3 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
S26A9 rabbit pAb
E28PN3643 100 µL

S26A9 rabbit pAb

Sign In for Pricing
View Details
HYAL1 Human Over-expression Lysate
orb1353662 100 µg

HYAL1 Human Over-expression Lysate

Sign In for Pricing
View Details
Human Cytochrome b5 type B, CYB5B ELISA Kit
MBS9335533-01 48 Well

Human Cytochrome b5 type B, CYB5B ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome b5 type B, CYB5B ELISA Kit
MBS9335533-02 96 Well

Human Cytochrome b5 type B, CYB5B ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome b5 type B, CYB5B ELISA Kit
MBS9335533-03 5x 96 Well

Human Cytochrome b5 type B, CYB5B ELISA Kit

Sign In for Pricing
View Details