Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human POU domain, class 5, transcription factor 1B (P5F1B)

This Recombinant Human POU domain, class 5, transcription factor 1B (P5F1B) spans the amino acid sequence from region 1-359. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

POU domain, class 5, transcription factor 1B; Oct4-pg1; Octamer-binding protein 3-like; Octamer-binding transcription factor 3-like; POU5F1B OCT4PG1 OTF3C OTF3P1 POU5F1P1 POU5FLC20 POU5FLC8

UniProt

Q06416

Expression Region

1-359

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPGAVKLEKEKLEQNPEKSQDIKALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFSQKTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLMQARKRKRTSIENRVRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPPAPGPHFGTPGYGSPHFTALYSSVPFPEGEVFPPVSVITLGSPMHSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCTN1 (NM_001135040) Human Over-expression Lysate
LC427531 20 µg

DCTN1 (NM_001135040) Human Over-expression Lysate

Sign In for Pricing
View Details
Xylene
TRC-X749400-100G 100 g

Xylene

Sign In for Pricing
View Details
Chlorocholine Chloride-d9
TRC-C364948-5MG 5 mg

Chlorocholine Chloride-d9

Sign In for Pricing
View Details
Colloidal Gold Conjugated Helix aspersa Lectin (Garden Snail) -HAA-,  20nm
GP-3801-20 1 mL

Colloidal Gold Conjugated Helix aspersa Lectin (Garden Snail) -HAA-, 20nm

Sign In for Pricing
View Details
Tissue Genomic DNA, Ovary: right
CD564966 5 µg

Tissue Genomic DNA, Ovary: right

Sign In for Pricing
View Details
Uba52 Mouse Gene Knockout Kit (CRISPR)
KN518547 1 Kit

Uba52 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details