Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP)

This Recombinant Human Complement component 1 Q subcomponent-binding protein, mitochondrial (C1QBP) spans the amino acid sequence from region 74-282. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complement component 1 Q subcomponent-binding protein, mitochondrial; ASF/SF2-associated protein p32; Glycoprotein gC1qBP; C1qBP; Hyaluronan-binding protein 1; Mitochondrial matrix protein p32; gC1q-R protein; p33; SF2AP32; C1QBP GC1QBP HABP1 SF2P32

UniProt

Q07021

Expression Region

74-282

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHA1, ID (PCDHA1, Protocadherin alpha-1) (AP)
MBS6331418-01 0.2 mL

PCDHA1, ID (PCDHA1, Protocadherin alpha-1) (AP)

Sign In for Pricing
View Details
PCDHA1, ID (PCDHA1, Protocadherin alpha-1) (AP)
MBS6331418-02 5x 0.2 mL

PCDHA1, ID (PCDHA1, Protocadherin alpha-1) (AP)

Sign In for Pricing
View Details
TBX3 Rabbit pAb, Pacific Blue conjugated
orb2880936 100 µL

TBX3 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Lentiviral mouse Rdh16 shRNA (UAS) - Lentiviral mouse Rdh16 shRNA (UAS) (25)
GTR15238805 1 Vial

Lentiviral mouse Rdh16 shRNA (UAS) - Lentiviral mouse Rdh16 shRNA (UAS) (25)

Sign In for Pricing
View Details
SNCG siRNA (Mouse)
orb1845460-01 15 nmol

SNCG siRNA (Mouse)

Sign In for Pricing
View Details
SNCG siRNA (Mouse)
orb1845460-02 30 nmol

SNCG siRNA (Mouse)

Sign In for Pricing
View Details