Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human mRNA decay activator protein ZFP36L1 (TISB)

This Recombinant Human mRNA decay activator protein ZFP36L1 (TISB) spans the amino acid sequence from region 1-338. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRNA decay activator protein ZFP36L1; Butyrate response factor 1; EGF-response factor 1; ERF-1; TPA-induced sequence 11b; Zinc finger protein 36, C3H1 type-like 1; ZFP36-like 1; ZFP36L1 BERG36 BRF1 ERF1 RNF162B TIS11B

UniProt

Q07352

Expression Region

1-338

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
30256061 1.0 µg DNA

MMP8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Translin (TSN) Human qPCR Template Standard (NM_004622)
HK207613 1 Kit

Translin (TSN) Human qPCR Template Standard (NM_004622)

Sign In for Pricing
View Details
NGDN (NM_001042635) Human Tagged ORF Clone Lentiviral Particle
RC204792L3V 200 µL

NGDN (NM_001042635) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
anti-FGG (4H9)
LF-MA30634 100 ul

anti-FGG (4H9)

Sign In for Pricing
View Details
Anti-STAT3 (Recombinant Rabbit, Monoclonal, IgG)
A105998 100 µL

Anti-STAT3 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
Retinoid X Receptor Alpha (RXRA) Antibody
abx032344-01 80 µL

Retinoid X Receptor Alpha (RXRA) Antibody

Sign In for Pricing
View Details