Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-actinin-3 (ACTN3), partial

This Recombinant Human Alpha-actinin-3 (ACTN3), partial spans the amino acid sequence from region 158-264. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3

UniProt

Q08043

Expression Region

158-264

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USF2 Rabbit Polyclonal Antibody
TA361921 100 µL

USF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCL2 Rabbit Polyclonal Antibody
AP09164PU-S 25 µL

CCL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: left upper lobe
CS716358 5x 5 µm

Tissue FFPE Sections, Lung: left upper lobe

Sign In for Pricing
View Details
CDC42SE2 Mouse Monoclonal Antibody [Clone ID: OTI10A5]
CF808200 100 µg

CDC42SE2 Mouse Monoclonal Antibody [Clone ID: OTI10A5]

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/1931), CF405S conjugate, 0.1mg/mL
BNC041931-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/1931), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS627743 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details