Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-actinin-3 (ACTN3), partial

This Recombinant Human Alpha-actinin-3 (ACTN3), partial spans the amino acid sequence from region 158-264. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3

UniProt

Q08043

Expression Region

158-264

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Salinomycin
TRC-S088700-25MG 25 mg

Salinomycin

Sign In for Pricing
View Details
Monohexyl Phthalate
TRC-M546480-1G 1 g

Monohexyl Phthalate

Sign In for Pricing
View Details
TCF3 / E2A (TCF3) (NM_001136139) Human Over-expression Lysate
LY427823 100 µg

TCF3 / E2A (TCF3) (NM_001136139) Human Over-expression Lysate

Sign In for Pricing
View Details
CD14 (NM_000591) Human Over-expression Lysate
LY424624 100 µg

CD14 (NM_000591) Human Over-expression Lysate

Sign In for Pricing
View Details
Heat Shock 27kDa Protein 1 (HPS27) (CPTC-HSPB1-2), CF640R conjugate, 0.1mg/mL
BNC402244-500 1x 500 µL

Heat Shock 27kDa Protein 1 (HPS27) (CPTC-HSPB1-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human SNCα Protein (Trx Tag)
PDEH101110-01 20 µg

Recombinant Human SNCα Protein (Trx Tag)

Sign In for Pricing
View Details