Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitotic-spindle organizing protein 1 (MZT1)

This Recombinant Human Mitotic-spindle organizing protein 1 (MZT1) spans the amino acid sequence from region 2-82. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitotic-spindle organizing protein 1; Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 1; MZT1 C13orf37 MOZART1

UniProt

Q08AG7

Expression Region

2-82

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENMTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS25P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV784229 1.0 µg DNA

RPS25P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Girdin (CCDC88A) Mouse ELISA Kit
D6860 96 Tests

Girdin (CCDC88A) Mouse ELISA Kit

Sign In for Pricing
View Details
PROKR2 Protein Vector (Mouse) (pPM-C-HA)
PV219620 500 ng

PROKR2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Sheep Plasminogen (PLG) ELISA Kit
orb1655059-01 48 Tests

Sheep Plasminogen (PLG) ELISA Kit

Sign In for Pricing
View Details
Sheep Plasminogen (PLG) ELISA Kit
orb1655059-02 96 Tests

Sheep Plasminogen (PLG) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 6 (IL6) ELISA Kit
RD-IL6-Mu-96Tests 96 Tests

Mouse Interleukin 6 (IL6) ELISA Kit

Sign In for Pricing
View Details