Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-binding cassette sub-family C member 8 (ABCC8), partial

This Recombinant Human ATP-binding cassette sub-family C member 8 (ABCC8), partial spans the amino acid sequence from region 320-356. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP-binding cassette sub-family C member 8; Sulfonylurea receptor 1; ABCC8 HRINS SUR SUR1

UniProt

Q09428

Expression Region

320-356

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IFGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A/G/L Sepharose Column
6548-1 1 mL

Protein A/G/L Sepharose Column

Sign In for Pricing
View Details
UTP14C (NM_021645) Human Tagged Lenti ORF Clone
RC218618L3 10 µg

UTP14C (NM_021645) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ARNTL Antibody
27-472 100 µL

ARNTL Antibody

Sign In for Pricing
View Details
DLX1 (Distal-less Homeobox 1, DLX 1, DLX-1, Homeobox Protein DLX1, OTTMUSP00000014202) (MaxLight 490)
MBS6200489-01 0.1 mL

DLX1 (Distal-less Homeobox 1, DLX 1, DLX-1, Homeobox Protein DLX1, OTTMUSP00000014202) (MaxLight 490)

Sign In for Pricing
View Details
DLX1 (Distal-less Homeobox 1, DLX 1, DLX-1, Homeobox Protein DLX1, OTTMUSP00000014202) (MaxLight 490)
MBS6200489-02 5x 0.1 mL

DLX1 (Distal-less Homeobox 1, DLX 1, DLX-1, Homeobox Protein DLX1, OTTMUSP00000014202) (MaxLight 490)

Sign In for Pricing
View Details
CB018, CT (C2orf18, Transmembrane protein C2orf18) (AP) discontinued
033230-AP 200 µL

CB018, CT (C2orf18, Transmembrane protein C2orf18) (AP) discontinued

Sign In for Pricing
View Details