Recombinant Human Voltage-gated inwardly rectifying potassium channel KCNH2 (KCNH2), partial
This Recombinant Human Voltage-gated inwardly rectifying potassium channel KCNH2 (KCNH2), partial spans the amino acid sequence from region 569-611. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Voltage-gated inwardly rectifying potassium channel KCNH2; Eag homolog; Ether-a-go-go-related gene potassium channel 1; ERG-1; Eag-related protein 1; Ether-a-go-go-related protein 1; H-ERG; hERG-1; hERG1; Potassium voltage-gated channel subfamily H member 2; Voltage-gated potassium channel subunit Kv11.1; KCNH2 ERG ERG1 HERG
UniProt
Q12809
Expression Region
569-611
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
YAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog