Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SH2 domain-containing adapter protein B (SHB)

This Recombinant Human SH2 domain-containing adapter protein B (SHB) spans the amino acid sequence from region 1-509. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SH2 domain-containing adapter protein B SHB

UniProt

Q15464

Expression Region

1-509

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Histone H2AE Antibody (RM225) [PerCP]
NBP3-26042PCP 0.1 mL

Rabbit Monoclonal Histone H2AE Antibody (RM225) [PerCP]

Sign In for Pricing
View Details
DDX17 polyclonal antibody
orb1719781-01 50 µL

DDX17 polyclonal antibody

Sign In for Pricing
View Details
DDX17 polyclonal antibody
orb1719781-02 100 µL

DDX17 polyclonal antibody

Sign In for Pricing
View Details
Phospho-Hormone Sensitive Lipase (Ser855) Rabbit pAb
APP1132-01 30 µL

Phospho-Hormone Sensitive Lipase (Ser855) Rabbit pAb

Sign In for Pricing
View Details
Phospho-Hormone Sensitive Lipase (Ser855) Rabbit pAb
APP1132-02 50 μL

Phospho-Hormone Sensitive Lipase (Ser855) Rabbit pAb

Sign In for Pricing
View Details
Phospho-Hormone Sensitive Lipase (Ser855) Rabbit pAb
APP1132-03 100 µL

Phospho-Hormone Sensitive Lipase (Ser855) Rabbit pAb

Sign In for Pricing
View Details