Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SH2 domain-containing adapter protein B (SHB)

This Recombinant Human SH2 domain-containing adapter protein B (SHB) spans the amino acid sequence from region 1-509. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SH2 domain-containing adapter protein B SHB

UniProt

Q15464

Expression Region

1-509

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Itsn2 (NM_001198969) Mouse Tagged ORF Clone
MR230794 10 µg

Itsn2 (NM_001198969) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RTF2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E10]
TA502421BM 100 µL

RTF2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E10]

Sign In for Pricing
View Details
BFSP1 3'UTR GFP Stable Cell Line
TU051763 1.0 mL

BFSP1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Chicken WD Repeat-Containing Protein 63 (WDR63) ELISA Kit
MBS9390511 Inquire

Chicken WD Repeat-Containing Protein 63 (WDR63) ELISA Kit

Sign In for Pricing
View Details
GREB1 (Protein GREB1, Gene Regulated in Breast Cancer 1 Protein, KIAA0575) (AP)
MBS6242013-01 0.1 mL

GREB1 (Protein GREB1, Gene Regulated in Breast Cancer 1 Protein, KIAA0575) (AP)

Sign In for Pricing
View Details
GREB1 (Protein GREB1, Gene Regulated in Breast Cancer 1 Protein, KIAA0575) (AP)
MBS6242013-02 5x 0.1 mL

GREB1 (Protein GREB1, Gene Regulated in Breast Cancer 1 Protein, KIAA0575) (AP)

Sign In for Pricing
View Details