Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (S35B2), partial
This Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (S35B2), partial spans the amino acid sequence from region 175-237. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Adenosine 3'-phospho 5'-phosphosulfate transporter 1; PAPS transporter 1; Putative MAPK-activating protein PM15; Putative NF-kappa-B-activating protein 48; Solute carrier family 35 member B2; SLC35B2 PAPST1 PSEC0149
UniProt
Q8TB61
Expression Region
175-237
Origin
Homo sapiens (Human)
Field of Research
Pharmacology & Drug Discovery
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
KQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSRRSYEH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP720244L 500 µg
AIF (AIFM1) (NM_001130846) Human Recombinant Protein
Sign In for Pricing
View Details 
