Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (S35B2), partial

This Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (S35B2), partial spans the amino acid sequence from region 175-237. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenosine 3'-phospho 5'-phosphosulfate transporter 1; PAPS transporter 1; Putative MAPK-activating protein PM15; Putative NF-kappa-B-activating protein 48; Solute carrier family 35 member B2; SLC35B2 PAPST1 PSEC0149

UniProt

Q8TB61

Expression Region

175-237

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSRRSYEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

a-Ethyl 2C-D Hydrochloride
TRC-E594260-5MG 5 mg

a-Ethyl 2C-D Hydrochloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Oropharynx
CS715861 5x 5 µm

Tissue FFPE Sections, Oropharynx

Sign In for Pricing
View Details
SP17 (SPA17) Mouse Monoclonal Antibody [Clone ID: OTI2G6]
CF804220 100 µg

SP17 (SPA17) Mouse Monoclonal Antibody [Clone ID: OTI2G6]

Sign In for Pricing
View Details
FSBP Human Gene Knockout Kit (CRISPR)
KN432412 1 Kit

FSBP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PNPLA3 (NM_025225) Human Recombinant Protein
TP750210 50 µg

PNPLA3 (NM_025225) Human Recombinant Protein

Sign In for Pricing
View Details
Human HTRA3 activation kit by CRISPRa
GA114318 1 Kit

Human HTRA3 activation kit by CRISPRa

Sign In for Pricing
View Details