Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (S35B2), partial

This Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (S35B2), partial spans the amino acid sequence from region 175-237. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenosine 3'-phospho 5'-phosphosulfate transporter 1; PAPS transporter 1; Putative MAPK-activating protein PM15; Putative NF-kappa-B-activating protein 48; Solute carrier family 35 member B2; SLC35B2 PAPST1 PSEC0149

UniProt

Q8TB61

Expression Region

175-237

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSRRSYEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SOD1 Antibody
RC-5122-01 50 μL

Recombinant SOD1 Antibody

Sign In for Pricing
View Details
Recombinant SOD1 Antibody
RC-5122-02 100 µL

Recombinant SOD1 Antibody

Sign In for Pricing
View Details
Recombinant SOD1 Antibody
RC-5122-03 1 mL

Recombinant SOD1 Antibody

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans ttr-3 Protein (aa 18-148)
VAng-Ly3872-1mgEcoli 1 mg (E. coli)

Recombinant Caenorhabditis Elegans ttr-3 Protein (aa 18-148)

Sign In for Pricing
View Details
Stra13 Mouse shRNA Plasmid (Locus ID 20892)
TR502169 1 Kit

Stra13 Mouse shRNA Plasmid (Locus ID 20892)

Sign In for Pricing
View Details
IRF5 Recombinant Antibody, PE-Cy7 Conjugated
bsm-52117R-PE-Cy7 100 µL

IRF5 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details