Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bcl-2-binding component 3, isoforms 3/4 (BBC3B)

This Recombinant Human Bcl-2-binding component 3, isoforms 3/4 (BBC3B) spans the amino acid sequence from region 1-261. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bcl-2-binding component 3, isoforms 3/4; JFY-1; p53 up-regulated modulator of apoptosis; BBC3 PUMA

UniProt

Q96PG8

Expression Region

1-261

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC1 (m) -PR
sc-149051-PR 10 µM - 20 µL

LRRC1 (m) -PR

Sign In for Pricing
View Details
HICE1 shRNA Plasmid (h)
sc-97388-SH 20 µg

HICE1 shRNA Plasmid (h)

Sign In for Pricing
View Details
Mtx2 3'UTR Lenti-reporter-Luc Vector
31124086 1.0 µg

Mtx2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
N- (2-Phenoxyethyl) butan-1-amine
OR1047366-01 100 mg

N- (2-Phenoxyethyl) butan-1-amine

Sign In for Pricing
View Details
N- (2-Phenoxyethyl) butan-1-amine
OR1047366-02 250 mg

N- (2-Phenoxyethyl) butan-1-amine

Sign In for Pricing
View Details
N- (2-Phenoxyethyl) butan-1-amine
OR1047366-03 1 g

N- (2-Phenoxyethyl) butan-1-amine

Sign In for Pricing
View Details