Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bcl-2-binding component 3, isoforms 3/4 (BBC3B)

This Recombinant Human Bcl-2-binding component 3, isoforms 3/4 (BBC3B) spans the amino acid sequence from region 1-261. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bcl-2-binding component 3, isoforms 3/4; JFY-1; p53 up-regulated modulator of apoptosis; BBC3 PUMA

UniProt

Q96PG8

Expression Region

1-261

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RUFY1 CRISPR Activation Plasmid (m)
sc-432110-ACT 20 µg

RUFY1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
DDC HDR Plasmid (m)
sc-419967-HDR 20 µg

DDC HDR Plasmid (m)

Sign In for Pricing
View Details
SAT1 Recombinant Protein (Mouse)
RP170033 100 µg

SAT1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
TAT (Tyrosine Aminotransferase) (AP)
MBS6449770-01 0.1 mL

TAT (Tyrosine Aminotransferase) (AP)

Sign In for Pricing
View Details
TAT (Tyrosine Aminotransferase) (AP)
MBS6449770-02 5x 0.1 mL

TAT (Tyrosine Aminotransferase) (AP)

Sign In for Pricing
View Details
Glycine Ethyl Ester Hydrochloride
MBS6083500-01 1 g

Glycine Ethyl Ester Hydrochloride

Sign In for Pricing
View Details