Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vitamin K epoxide reductase complex subunit 1 (VKOR1), partial

This Recombinant Human Vitamin K epoxide reductase complex subunit 1 (VKOR1), partial spans the amino acid sequence from region 30-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vitamin K epoxide reductase complex subunit 1; EC 1.17.4.4; Vitamin K1 2,3-epoxide reductase subunit 1; VKORC1 VKOR MSTP134 MSTP576 UNQ308/PRO351

UniProt

Q9BQB6

Expression Region

30-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CDK2 Antibody
RC-7038-01 50 μL

Recombinant CDK2 Antibody

Sign In for Pricing
View Details
Recombinant CDK2 Antibody
RC-7038-02 100 µL

Recombinant CDK2 Antibody

Sign In for Pricing
View Details
Recombinant CDK2 Antibody
RC-7038-03 1 mL

Recombinant CDK2 Antibody

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), CF594 conjugate, 0.1mg/mL
BNC942149-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CENPE Recombinant Rabbit Monoclonal Antibody [PSH03-54]
HA722013 100 µL

CENPE Recombinant Rabbit Monoclonal Antibody [PSH03-54]

Sign In for Pricing
View Details
Mouse Nr1h3 activation kit by CRISPRa
GA204549 1 Kit

Mouse Nr1h3 activation kit by CRISPRa

Sign In for Pricing
View Details