Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vitamin K epoxide reductase complex subunit 1 (VKOR1), partial

This Recombinant Human Vitamin K epoxide reductase complex subunit 1 (VKOR1), partial spans the amino acid sequence from region 30-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vitamin K epoxide reductase complex subunit 1; EC 1.17.4.4; Vitamin K1 2,3-epoxide reductase subunit 1; VKORC1 VKOR MSTP134 MSTP576 UNQ308/PRO351

UniProt

Q9BQB6

Expression Region

30-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurogenin 1 (NEUROG1) Mouse Monoclonal Antibody [Clone ID: LBI6C9]
AMM09009VCF 100 µg

Neurogenin 1 (NEUROG1) Mouse Monoclonal Antibody [Clone ID: LBI6C9]

Sign In for Pricing
View Details
LUZP2 Human shRNA Lentiviral Particle (Locus ID 338645)
TL311643V 500 µL Each

LUZP2 Human shRNA Lentiviral Particle (Locus ID 338645)

Sign In for Pricing
View Details
PE/Cyanine7 anti-mouse CD319
GT02597 25 µg

PE/Cyanine7 anti-mouse CD319

Sign In for Pricing
View Details
MPZ Polyclonal Antibody
A70986-050 50 µL

MPZ Polyclonal Antibody

Sign In for Pricing
View Details
Acetyl-Histone H4 (Lys5) Antibody
CSB-PA833785 100 µL

Acetyl-Histone H4 (Lys5) Antibody

Sign In for Pricing
View Details
CD2 (Erythrocyte receptor, LFA-2, LFA-3 receptor, Ly-37, Lymphocyte function antigen 2, Rosette receptor, SRBC, T-cell surface antigen CD2, T-cell surface antigen T11/Leu-5, T11) (BSA & Azide Free) (MaxLight 405)
MBS6193706-01 0.1 mL

CD2 (Erythrocyte receptor, LFA-2, LFA-3 receptor, Ly-37, Lymphocyte function antigen 2, Rosette receptor, SRBC, T-cell surface antigen CD2, T-cell surface antigen T11/Leu-5, T11) (BSA & Azide Free) (MaxLight 405)

Sign In for Pricing
View Details