Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human KxDL motif-containing protein 1 (KXDL1)

This Recombinant Human KxDL motif-containing protein 1 (KXDL1) spans the amino acid sequence from region 1-176. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KxDL motif-containing protein 1 KXD1 C19orf50

UniProt

Q9BQD3

Expression Region

1-176

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQPGSPAINGRSQTDDEEMTGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFN-γ (E-10) AC
sc-373727 AC 500 µg/mL - 25% ag

IFN-γ (E-10) AC

Sign In for Pricing
View Details
LDB1 Rabbit Polyclonal Antibody (FITC)
orb2130102 100 µL

LDB1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Gm13305 3'UTR GFP Stable Cell Line
TU157554 1.0 mL

Gm13305 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
FHL2 Rabbit mAb Antibody
orb1950739-01 50 µL

FHL2 Rabbit mAb Antibody

Sign In for Pricing
View Details
FHL2 Rabbit mAb Antibody
orb1950739-02 100 µL

FHL2 Rabbit mAb Antibody

Sign In for Pricing
View Details
FAM53C Human Over-expression Lysate
orb1348997 100 µg

FAM53C Human Over-expression Lysate

Sign In for Pricing
View Details