Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myb-binding protein 1A (MBB1A), partial

This Recombinant Human Myb-binding protein 1A (MBB1A), partial spans the amino acid sequence from region 1-500. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myb-binding protein 1A MYBBP1A P160

UniProt

Q9BQG0

Expression Region

1-500

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MESRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLAATEKLLEYLRGRPKGSEMKYALKRLITGLGVGRETARPCYSLALAQLLQSFEDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVGSVNLFSDENVPRLVNVLKMAASSVKKDRKLPAIALDLLRLALKEDKFPRFWKEVVEQGLLKMQFWPASYLCFRLLGAALPLLTKEQLHLVMQGDVIRHYGEHVCTAKLPKQFKFAPEMDDYVGTFLEGCQDDPERQLAVLVAFSSVTNQGLPVTPTFWRVVRFLSPPALQGYVAWLRAMFLQPDLDSLVDFSTNNQKKAQDSSLHMPERAVFRLRKWIIFRLVSIVDSLHLEMEEALTEQVARFCLFHSFFVTKKPTSQIPETKHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPG Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62482R-BF750-01 20 µL

OPG Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
OPG Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62482R-BF750-02 100 µL

OPG Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
APOBEC3C Knockout huh-7 Polyclonal Cells
ARG27939 1 Million

APOBEC3C Knockout huh-7 Polyclonal Cells

Sign In for Pricing
View Details
6,7-Dinitroquinoxaline-2,3-dione (DNQX)
D8061-30 100 mg

6,7-Dinitroquinoxaline-2,3-dione (DNQX)

Sign In for Pricing
View Details
Tofacitinib Impurity 37
RM-T060475-01 10 mg

Tofacitinib Impurity 37

Sign In for Pricing
View Details
Tofacitinib Impurity 37
RM-T060475-02 25 mg

Tofacitinib Impurity 37

Sign In for Pricing
View Details