Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (S35B3), partial

This Recombinant Human Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (S35B3), partial spans the amino acid sequence from region 1-77. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenosine 3'-phospho 5'-phosphosulfate transporter 2; 3'-phosphoadenosine 5'-phosphosulfate transporter; PAPS transporter 2; Solute carrier family 35 member B3; SLC35B3 C6orf196 PAPST2 CGI-19

UniProt

Q9H1N7

Expression Region

1-77

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKFNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau (T175) polyclonal antibody
BS1350 50ul

Tau (T175) polyclonal antibody

Sign In for Pricing
View Details
ATP6V1H (V-type Proton ATPase Subunit H, V-ATPase Subunit H, Nef-binding Protein 1, NBP1, Protein VMA13 Homolog, V-ATPase 50/57kD Subunits, Vacuolar Proton Pump Subunit H, Vacuolar Proton Pump Subunit SFD, CGI-11) (Biotin)
123741-Biotin 100 µL

ATP6V1H (V-type Proton ATPase Subunit H, V-ATPase Subunit H, Nef-binding Protein 1, NBP1, Protein VMA13 Homolog, V-ATPase 50/57kD Subunits, Vacuolar Proton Pump Subunit H, Vacuolar Proton Pump Subunit SFD, CGI-11) (Biotin)

Sign In for Pricing
View Details
SOAT2 (ACAT-2) Alexa Fluor® 680
sc-69837 AF680 200 µg/mL

SOAT2 (ACAT-2) Alexa Fluor® 680

Sign In for Pricing
View Details
Rabbit Heme oxygenase 2, HMOX2 ELISA Kit
MBS9316550 Inquire

Rabbit Heme oxygenase 2, HMOX2 ELISA Kit

Sign In for Pricing
View Details
Magic™ Membrane Protein Human ATAD3A (ATPase family AAA domain containing 3A) Full Length
MPC2785K Each

Magic™ Membrane Protein Human ATAD3A (ATPase family AAA domain containing 3A) Full Length

Sign In for Pricing
View Details
EQTN Antibody
E40PV4744 50 µL

EQTN Antibody

Sign In for Pricing
View Details