Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuronal-specific septin-3 (SEPT3)

This Recombinant Human Neuronal-specific septin-3 (SEPT3) spans the amino acid sequence from region 1-358. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuronal-specific septin-3 SEPTIN3 SEP3 SEPT3

UniProt

Q9UH03

Expression Region

1-358

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL2 pThr56 Rabbit Polyclonal Antibody
AP01537PU-N 100 µg

BCL2 pThr56 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,2-Pentanediol
TRC-P227285-10G 10 g

1,2-Pentanediol

Sign In for Pricing
View Details
Sntg1 Mouse Gene Knockout Kit (CRISPR)
KN516415 1 Kit

Sntg1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
b-Geranyl Acetate
TRC-G367210-25G 25 g

b-Geranyl Acetate

Sign In for Pricing
View Details
Delta2-Cefcapene Pivoxil
TRC-C242560-5MG 5 mg

Delta2-Cefcapene Pivoxil

Sign In for Pricing
View Details
Human GTF2H2C activation kit by CRISPRa
GA118928 1 Kit

Human GTF2H2C activation kit by CRISPRa

Sign In for Pricing
View Details