Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human General transcription factor II-I repeat domain-containing protein 1 (GT2D1), partial

This Recombinant Human General transcription factor II-I repeat domain-containing protein 1 (GT2D1), partial spans the amino acid sequence from region 565-650. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

General transcription factor II-I repeat domain-containing protein 1; GTF2I repeat domain-containing protein 1; General transcription factor III; MusTRD1/BEN; Muscle TFII-I repeat domain-containing protein 1; Slow-muscle-fiber enhancer-binding protein; USE B1-binding protein; Williams-Beuren syndrome chromosomal region 11 protein; Williams-Beuren syndrome chromosomal region 12 protein; GTF2IRD1 CREAM1 GTF3 MUSTRD1 RBAP2 WBSCR11 WBSCR12

UniProt

Q9UHL9

Expression Region

565-650

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRKQVELLFNTRYAKAIGISEPVKVPYSKFLMHPEELFVVGLPEGISLRRPNCFGIAKLRKILEASNSIQFVIKRPELLTEGVKEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 antigen (CD81) Mouse ELISA Kit
C2395 96 Tests

CD81 antigen (CD81) Mouse ELISA Kit

Sign In for Pricing
View Details
Acetyl-CoA Carboxylase Activity Colorimetric Microplate Assay Kit
orb545618 100 assay

Acetyl-CoA Carboxylase Activity Colorimetric Microplate Assay Kit

Sign In for Pricing
View Details
IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (AP) discontinued
247625-AP 100 µL

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (AP) discontinued

Sign In for Pricing
View Details
DRAM1 ELISA Kit (Human) (OKEH01714)
OKEH01714 96 Well

DRAM1 ELISA Kit (Human) (OKEH01714)

Sign In for Pricing
View Details
PHLDA3 (A-10) : m-IgG1 BP-HRP Bundle
sc-551042 1 Kit

PHLDA3 (A-10) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Cbx2 (NM_001107071) Rat Tagged ORF Clone Lentiviral Particle
RR212283L3V 200 µL

Cbx2 (NM_001107071) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details