Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein jagged-2 (JAG2), partial

This Recombinant Human Protein jagged-2 (JAG2), partial spans the amino acid sequence from region 870-944. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein jagged-2; Jagged2; hJ2; JAG2

UniProt

Q9Y219

Expression Region

870-944

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI3D7]
CF808375 100 µg

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI3D7]

Sign In for Pricing
View Details
OR5BB1P sgRNA CRISPR Lentivector (Human) (Target 1)
K1518102 1.0 µg DNA

OR5BB1P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Klk15 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4285103 1.0 µg DNA

Klk15 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
FAM149A (NM_001006655) Human Tagged ORF Clone
RC224918 10 µg

FAM149A (NM_001006655) Human Tagged ORF Clone

Sign In for Pricing
View Details
CF®543 Goat Anti-Guinea Pig IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL
#20490-50uL 1x 50 µL

CF®543 Goat Anti-Guinea Pig IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL

Sign In for Pricing
View Details
Tmem72 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6630006 1.0 µg DNA

Tmem72 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details