Recombinant Human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 (PIN4)
This Recombinant Human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 (PIN4) spans the amino acid sequence from region 1-131. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4; EC 5.2.1.8; Parvulin-14; Par14; hPar14; Parvulin-17; Par17; hPar17; Peptidyl-prolyl cis-trans isomerase Pin4; PPIase Pin4; Peptidyl-prolyl cis/trans isomerase EPVH; hEPVH; Rotamase Pin4; PIN4
UniProt
Q9Y237
Expression Region
1-131
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
45097-AAT 200 Slides
IFluor® 450 Tyramide *Superior Replacement for Opal 480*
Sign In for Pricing
View Details 
BNC942200-500 1x 500 µL
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
