Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PAT complex subunit Asterix (ASTER), partial

This Recombinant Human PAT complex subunit Asterix (ASTER), partial spans the amino acid sequence from region 2-32. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PAT complex subunit Asterix; Protein associated with the ER translocon of 10kDa; PAT-10; PAT10; WD repeat domain 83 opposite strand; WDR83 opposite strand; WDR83OS C19orf56 CGI-140 My006 PTD008

UniProt

Q9Y284

Expression Region

2-32

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

STNNMSDPRRPNKVLRYKPPPSECNPALDDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific,  30nm
GAF-451-30 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific, 30nm

Sign In for Pricing
View Details
Nfkb2 (NM_001177370) Mouse Tagged Lenti ORF Clone
MR211094L3 10 µg

Nfkb2 (NM_001177370) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-VEGFC Antibody (R3M02)
RHE70401 100 μg

Anti-VEGFC Antibody (R3M02)

Sign In for Pricing
View Details
OTOP2 Protein Vector (Mouse) (pPM-C-HA)
PV212824 500 ng

OTOP2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Slc35a4 shRNA (UAS) - Lentiviral mouse Slc35a4 shRNA (UAS, iRFP) plasmid
GTR15126424 1 Vial

Lentiviral mouse Slc35a4 shRNA (UAS) - Lentiviral mouse Slc35a4 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SST Recombinant Protein
OPCD07202-50UG 50 µg

SST Recombinant Protein

Sign In for Pricing
View Details