Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human AP-3 complex subunit mu-1 (AP3M1)

This Recombinant Human AP-3 complex subunit mu-1 (AP3M1) spans the amino acid sequence from region 1-418. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AP-3 complex subunit mu-1; AP-3 adaptor complex mu3A subunit; Adaptor-related protein complex 3 subunit mu-1; Mu-adaptin 3A; Mu3A-adaptin; AP3M1

UniProt

Q9Y2T2

Expression Region

1-418

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIYRDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Thyroglobulin (TG) ELISA Kit
RK14003 96 Tests

Mouse Thyroglobulin (TG) ELISA Kit

Sign In for Pricing
View Details
RGD1563217 (NM_001109155) Rat Tagged Lenti ORF Clone
RR201076L3 10 µg

RGD1563217 (NM_001109155) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Z-Cys(Z)-OH
5-07230 100 g

Z-Cys(Z)-OH

Sign In for Pricing
View Details
Olfr1106 AAV siRNA Pooled Vector
32584164 1.0 µg

Olfr1106 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Rchy1 (NM_026557) AAV Particle
MR203406A1V 250 µL

Mouse Rchy1 (NM_026557) AAV Particle

Sign In for Pricing
View Details
BCAT1 discontinued
386375-01 20 µL

BCAT1 discontinued

Sign In for Pricing
View Details