Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human U6 snRNA-associated Sm-like protein LSm2 (LSM2)

This Recombinant Human U6 snRNA-associated Sm-like protein LSm2 (LSM2) spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

U6 snRNA-associated Sm-like protein LSm2; Protein G7b; Small nuclear ribonuclear protein D homolog; snRNP core Sm-like protein Sm-x5; LSM2 C6orf28 G7B

UniProt

Q9Y333

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hu CD120a Purified TNFRSF1A Monoclonal Antibody
M00294 0.1 mg

Anti-Hu CD120a Purified TNFRSF1A Monoclonal Antibody

Sign In for Pricing
View Details
TBCE (Tubulin-specific Chaperone E, Tubulin-folding Cofactor E) (MaxLight 650)
134248-ML650 100 µL

TBCE (Tubulin-specific Chaperone E, Tubulin-folding Cofactor E) (MaxLight 650)

Sign In for Pricing
View Details
Angiotensin II Type 1 Receptor Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-23775R-BF680 100 µL

Angiotensin II Type 1 Receptor Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
iFluor™ 647 Conjugated Sodium Potassium ATPase Recombinant Rabbit Monoclonal Antibody [ST0533]
HA720176F 100 µL

iFluor™ 647 Conjugated Sodium Potassium ATPase Recombinant Rabbit Monoclonal Antibody [ST0533]

Sign In for Pricing
View Details
RPL17 Antibody
orb1257244 100 µL

RPL17 Antibody

Sign In for Pricing
View Details
HOXC11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A10]
TA502574BM 100 µL

HOXC11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A10]

Sign In for Pricing
View Details